SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|177473|fgenesh2_kg.4__156__295_1_CCGZ from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|177473|fgenesh2_kg.4__156__295_1_CCGZ
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-30
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|177473|fgenesh2_kg.4__156__295_1_CCGZ
Sequence length 107
Sequence
MTVHNIATVEEFKEAIAKNPIVVLDAFATWCGPCKAIAPTVAKWSEEPQFKDTVYFAKFD
VDALPDLAQELGIRAMPTFVIFKNGDKADEFVGANPPALLATITKQL
Download sequence
Identical sequences F8MI42 G4UMB9
XP_009849197.1.73169 jgi|Neute1|177473|fgenesh2_kg.4__156__295_1_CCGZ

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]