SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|190026|estExt_fgenesh2_kg.C_160007 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|190026|estExt_fgenesh2_kg.C_160007
Domain Number 1 Region: 9-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-66
Family Glutathione peroxidase-like 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|190026|estExt_fgenesh2_kg.C_160007
Sequence length 225
Sequence
MASTDRNAPLRLGTIAPNFQADTTTGPIDFHEFIGDNWVILFSHPEDYTPVCTTELGEMA
RLEPEFKKRGVKLIGLSANTLGSHEGWINDIKDVTGSQVQFPIIADKERKVAYLYDMLDY
QDTTNVDEKGIAFTIRSVFVIDPKKTIRTILAYPASTGRNSAEILRIVDSLQTGDKHKVT
TPINWVPGDDVIVHPSIKGEEATRLFPNLKAVKPYLRFTPLPKDA
Download sequence
Identical sequences A0A0B0E311 F8MXV4 G4URP8 Q7S4F4
XP_009854856.1.73169 XP_959621.1.24337 jgi|Neute1|190026|estExt_fgenesh2_kg.C_160007 5141.NCU06031.1 NCU06031T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]