SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Neute1|97277|estExt_Genewise1.C_50719 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|97277|estExt_Genewise1.C_50719
Domain Number 1 Region: 13-73
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000136
Family Thioltransferase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Neute1|97277|estExt_Genewise1.C_50719
Sequence length 108
Sequence
MRLTSRLLQSFPSRITFFRREGCGLCVQARSVLSDVWDRRPFEYKEVDIVKPESKAWRDL
YDFDVPVIHISKAQAPEEDPQLSSKAVKLMHRFTVEQVETKMNQVEES
Download sequence
Identical sequences F8N4V1
jgi|Neute1|97277|estExt_Genewise1.C_50719 XP_009856372.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]