SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375284534|ref|YP_005104973.1| from Bacillus cereus NC7401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375284534|ref|YP_005104973.1|
Domain Number 1 Region: 247-568
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-67
Family Thermolysin-like 0.0000011
Further Details:      
 
Weak hits

Sequence:  gi|375284534|ref|YP_005104973.1|
Domain Number - Region: 712-741
Classification Level Classification E-value
Superfamily PKD domain 0.00196
Family PKD domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375284534|ref|YP_005104973.1|
Sequence length 891
Comment bacillolysin [Bacillus cereus NC7401]
Sequence
MKNKKEIAIVALTTGLALTSIVPYEKGYAEETDQMQVDIQEDSFRTGELTKPSQKTPENV
VKDALKEKTEHALSPKQVSGDKGVDYKVLQKRGSYDGTTLVRMQQIYEGKEVYGHQLTAH
VDKKGIIKSVSGESAQNLEKEDLKNPINLSKEEAKQYIYTKYGNDIQFISEAEVKEVIFV
DENRGQATNAYQVTFAAATPNYVSGTYLVDAHSGDMLKNMVQESDLKVNEERVEAIQESK
KSNFKSLTGTGKDDLGITRTFGISEQSNGKYALADYTRGQGIETYDVNYRDITFEEKYYP
GILTTSTSTTFNDPKAVSAHFLATNVYDFYKDKYKRNSFDNKGKKVVSVVHAWDSGETSD
PKNWGNAFSANINNVSMLIYGDPMVRSFDIAGHEFTHAVTSSESNLEFFGESGAINEALS
DIMGTAIEKYINNGEFNWTIGEQSGSVLRNMKNPSSVKFFNGVPYPDDYSKYSDLNGEDN
EGVHFNSSIINKVAYLIAQGGTHNGVTVNGIGEDKMFDIFYYANTDELNMTSNFSELRLA
CLKVATNKYGANSIEVETVQKAFDAAKIKGTVKENEKTEANQVPELTVPPTITLRVGDKF
DPMSNIKAIDKEDGDLTNRVEHKGDVDTSKPGKYIVDYSVVDSQGGKATVTQTVIVERDG
ETSDLKPTLTVPIATTITVGESFDPMEKVKAIDKEDGDLTSKVKVEGEVDTSKVGTYIVT
YTVTNSKGHEEIAKQTVTVTGREEVKNDIPILKVPSTTTITKGDEFNPMVGVSATDKEDG
DLTSKVVYKDIGDTTKVGTFEIIYSVTDSVGNKVHAIQKVLVKDTDASKAKGSTNNSNSG
NIQNNSNSDKKESTYKELPNTGGSTTNSTTMGLWMVFAGIVFTLVRKFRKI
Download sequence
Identical sequences A0A229MUS1 A0A2A6FZB6 B7HS87 C2S3Z6
gi|217960020|ref|YP_002338576.1| WP_000791137.1.13299 WP_000791137.1.18840 WP_000791137.1.24377 WP_000791137.1.26499 WP_000791137.1.27334 WP_000791137.1.31685 WP_000791137.1.32522 WP_000791137.1.33061 WP_000791137.1.43762 WP_000791137.1.46746 WP_000791137.1.48164 WP_000791137.1.48311 WP_000791137.1.48599 WP_000791137.1.51087 WP_000791137.1.52756 WP_000791137.1.55057 WP_000791137.1.59773 WP_000791137.1.72514 WP_000791137.1.77576 WP_000791137.1.79658 WP_000791137.1.82986 WP_000791137.1.8923 WP_000791137.1.99266 gi|375284534|ref|YP_005104973.1| 405534.BCAH187_A2624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]