SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375284983|ref|YP_005105422.1| from Bacillus cereus NC7401

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|375284983|ref|YP_005105422.1|
Domain Number - Region: 7-72
Classification Level Classification E-value
Superfamily PKD domain 0.0942
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375284983|ref|YP_005105422.1|
Sequence length 123
Comment hypothetical protein BCN_2889 [Bacillus cereus NC7401]
Sequence
MKSLLQKTLAVTGLTASLLGMVSSVSFASISWDNSARWSGAGSKATATAYTAKSNEPLMY
KMTVTAKFSDGSFRKEEVDNARITDRIDLEISSKGKVHGGYSTHEWSVVEDDSAFAYKEM
AIK
Download sequence
Identical sequences A0A0F5RJE9 A0A1Y6B121 A0A229MRP4 A0A243NFC3 B7HVR3 B9J552 C2S594
361100.BCQ_2866 405534.BCAH187_A3084 gi|217960472|ref|YP_002339034.1| WP_000838697.1.100684 WP_000838697.1.10069 WP_000838697.1.101309 WP_000838697.1.10762 WP_000838697.1.13024 WP_000838697.1.13299 WP_000838697.1.17408 WP_000838697.1.18840 WP_000838697.1.20687 WP_000838697.1.24184 WP_000838697.1.24377 WP_000838697.1.26499 WP_000838697.1.27334 WP_000838697.1.29209 WP_000838697.1.31685 WP_000838697.1.32522 WP_000838697.1.33045 WP_000838697.1.33061 WP_000838697.1.3318 WP_000838697.1.35255 WP_000838697.1.3615 WP_000838697.1.37093 WP_000838697.1.37990 WP_000838697.1.43762 WP_000838697.1.44463 WP_000838697.1.46746 WP_000838697.1.46864 WP_000838697.1.47097 WP_000838697.1.48164 WP_000838697.1.48599 WP_000838697.1.49428 WP_000838697.1.50316 WP_000838697.1.50514 WP_000838697.1.51087 WP_000838697.1.52756 WP_000838697.1.54775 WP_000838697.1.54782 WP_000838697.1.55057 WP_000838697.1.56055 WP_000838697.1.57203 WP_000838697.1.57815 WP_000838697.1.57859 WP_000838697.1.58814 WP_000838697.1.59773 WP_000838697.1.60274 WP_000838697.1.64377 WP_000838697.1.6753 WP_000838697.1.69970 WP_000838697.1.70645 WP_000838697.1.72514 WP_000838697.1.77576 WP_000838697.1.77690 WP_000838697.1.79658 WP_000838697.1.81088 WP_000838697.1.82533 WP_000838697.1.82986 WP_000838697.1.84337 WP_000838697.1.8450 WP_000838697.1.8923 WP_000838697.1.91404 WP_000838697.1.93932 WP_000838697.1.95457 WP_000838697.1.95484 WP_000838697.1.99266 gi|375284983|ref|YP_005105422.1| gi|222096526|ref|YP_002530583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]