SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375285421|ref|YP_005105860.1| from Bacillus cereus NC7401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375285421|ref|YP_005105860.1|
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.54e-29
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 5.23e-23
Family PKD domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375285421|ref|YP_005105860.1|
Sequence length 971
Comment microbial collagenase [Bacillus cereus NC7401]
Sequence
MKGYSKKVLVGVSFASFMLGSFQGDALAEGTKGEQVSYRNVLKMEPIGLQLPVQELAHSS
KVLENKSFEKRLKFADLSQRPPEVKKESKQLAVAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRMQAIIDKLNQQGQAYTKDDSKGIETLVEVLRSGFYLGFY
HTELSKLNERSYHDKCLPALKTIANNSNFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTLVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPEDTIWYQKIDSYIN
ELSRFALIGTVTAKNGWLINNGIYYTGRLGTFHSTETKGLQVVTDAMKIYPYLGEQYFVA
AEQIATNYGGKDANGKVVDLDQIREDGKKKYLPKTYTFDDGAIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNPDDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKMYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKIHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNREKYNVPLVSDDYLA
THAPKPVSDIAAEITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTAKGEYEDWKTITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNAAGQFEYDVVFHGINTEEGAVNKAPVAVING
PYSGNVNAAISFKSDGSKDEDGKIVAYKWEFGDGTVSNEQNPTHVYTKEGTYTAKLTVTD
DKGLTNTATTNVTVQKKEDNSVEKEPNNSFQTANKLQFNQVLRASLGNGDTSDYFEINVE
TAKNLQINVTKENNIGVNWVLYSEADLNNYVTYAQQEGNKLVGSYYTYPGKYYLHVYQYG
GGTGNYTVEVK
Download sequence
Identical sequences A0A1Y6AQB0 A0A229MLC9 A0A243NV63 C2S6J3
WP_000679534.1.100684 WP_000679534.1.10069 WP_000679534.1.101309 WP_000679534.1.13299 WP_000679534.1.18840 WP_000679534.1.24377 WP_000679534.1.26499 WP_000679534.1.27334 WP_000679534.1.31685 WP_000679534.1.32522 WP_000679534.1.33061 WP_000679534.1.43762 WP_000679534.1.46746 WP_000679534.1.47097 WP_000679534.1.48164 WP_000679534.1.48599 WP_000679534.1.51087 WP_000679534.1.52756 WP_000679534.1.55057 WP_000679534.1.59773 WP_000679534.1.6753 WP_000679534.1.72514 WP_000679534.1.77576 WP_000679534.1.79658 WP_000679534.1.8450 WP_000679534.1.91404 WP_000679534.1.99266 gi|375285421|ref|YP_005105860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]