SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375282628|ref|YP_005103065.1| from Bacillus cereus NC7401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375282628|ref|YP_005103065.1|
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.09e-30
Family Collagen-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 733-850
Classification Level Classification E-value
Superfamily PKD domain 1.57e-18
Family PKD domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375282628|ref|YP_005103065.1|
Sequence length 965
Comment microbial collagenase [Bacillus cereus NC7401]
Sequence
MNKKSKINKVMLSISTMALSLGALQAPASAEEKVPYNVLKTKPVGIEKPVDEIGHVSKAE
ETLSFQERLKVGDFSQRPASIPNKAAVKQVKESYSMADLNKMNDQELVETLGCIKWHQIT
DLFQFNEDTKAFYKDKGKMQVIIDELAHRGSTFTRDDSKGIQTFTEVLRSAFYLAFYNNE
LSELNERSFQDKCLPALKSIAKNPNFKLGTAEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNFNTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARKEANETMWYGKVDGFINEIN
RIALLNEVTPENKWLVNNGIYFASRFGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDPKLNKEYQEYMQQLIDNQDKYNVPAVADDYLAEHA
PKSLTAVEKEMTETLPMKDAKMTKHSSQFFNTFTLEGTYTGSVTKGESEDWNAMSKKVNE
VLEQLAQKEWSGYKTVTAYFVNYRVNSSNEFEYDVVFHGIAKDDGENKAPTVNINGPYNG
LVKEGIQFKSDGSKDEDGKIVSYLWDFGDGRTSTEVNPVHVYEREGSYKVALIVKDDKGK
ESKSETTVTVKDGSLTESEPNNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKDID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEANFNAKPGEYYLYVYKYDNGDGTY
KLSVK
Download sequence
Identical sequences B7HV61 C2RYS5
405534.BCAH187_A0684 gi|217958143|ref|YP_002336687.1| gi|375282628|ref|YP_005103065.1| WP_001036388.1.24377 WP_001036388.1.32522 WP_001036388.1.43762 WP_001036388.1.47097 WP_001036388.1.82986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]