SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386758482|ref|YP_006231698.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386758482|ref|YP_006231698.1|
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.36e-37
Family SMI1/KNR4-like 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386758482|ref|YP_006231698.1|
Sequence length 152
Comment SMI1 / KNR4 family protein [Bacillus sp. JS]
Sequence
MDYSKVKTFFDENKENSILTGGVTEDQVREIEEDLNVPLPDSYKWFLTEYGSGGAYGTMI
LGYDFHGAEVVEQTNEYKKYYNLFDGLVVIEYVDEFSYCLDTNKIKEGECPVILWDNQEG
YGKQVGSTFLEFLIEELEETKDDWIDDGDWDD
Download sequence
Identical sequences I0F4N6
WP_014664081.1.91225 gi|386758482|ref|YP_006231698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]