SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386758633|ref|YP_006231849.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386758633|ref|YP_006231849.1|
Domain Number 1 Region: 55-190
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-18
Family SMI1/KNR4-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386758633|ref|YP_006231849.1|
Sequence length 200
Comment SMI1 / KNR4 family protein [Bacillus sp. JS]
Sequence
MEFEGLLLKGNKGVMYLTNFVHKTVNGLKSLLDEKGAIKLFCSEGDIMEFLVTFSQDKAT
QNDIQSFEAKHQLTLPDDYKKFITLHNGAKIFQILADGENIGGGLYLFSLEEIEEELKYE
DLFESINGIPIGHLLEGCHLMIDKDKLDKGDPNYLFILGIGEYTPLNLNFEIFLDRYIES
NGATFWEWRYYTAENYYRTR
Download sequence
Identical sequences I0F537
gi|386758633|ref|YP_006231849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]