SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386759072|ref|YP_006232288.1| from Bacillus sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386759072|ref|YP_006232288.1|
Domain Number 1 Region: 231-370
Classification Level Classification E-value
Superfamily CBS-domain pair 2.78e-27
Family CBS-domain pair 0.0022
Further Details:      
 
Domain Number 2 Region: 381-458
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000545
Family CorC/HlyC domain-like 0.0035
Further Details:      
 
Weak hits

Sequence:  gi|386759072|ref|YP_006232288.1|
Domain Number - Region: 194-221
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0628
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386759072|ref|YP_006232288.1|
Sequence length 460
Comment hypothetical protein MY9_2499 [Bacillus sp. JS]
Sequence
MSIFRWYGMEKDIGKGRCMPSLEKAVVLEFVNLLAVAILILLTGFFVAIEFSIVKVRRSR
IDQLVAKGKKGAKAAKHVITHLDEYLSACQLGITVAALGLGWLGEPTVQTLLRPLFHKAG
LNESLTHLLSLVIAFLAVTYLNVVIGELAPKSFAIQKAESITLLFAKPLIWFYKIMFPFI
WLLNHSARLITGVFGLKPASEHELAYTEEELRVLLAESYKSGEIRKSELKYMNNIFTFDK
RMAKEIMVPRNEMVSLSLDEGSISNLQETVKQTKYTRYPVVREDKDNVIGVINMKEVLFS
MLTKDFSLKKHQIEPFVQPVIHVIETIPIYKLLLKMQKERTHMAILIDEYGGTSGLVTVE
DIIEEIVGEIRDEFDADEVPHIRELGKDHYLLNAKLLITDVNSLLGTDLSDAEVDTLGGW
FLTQNIDAEPESVIEYDGYSFKVKDIDSHHILFIEVKKAE
Download sequence
Identical sequences I0F6C6
gi|386759072|ref|YP_006232288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]