SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|350265437|ref|YP_004876744.1| from Bacillus subtilis subsp. spizizenii TU-B-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350265437|ref|YP_004876744.1|
Domain Number 1 Region: 19-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.25e-29
Family DsbC/DsbG C-terminal domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|350265437|ref|YP_004876744.1|
Sequence length 299
Comment hypothetical protein GYO_1460 [Bacillus subtilis subsp. spizizenii TU-B-10]
Sequence
MTNYQHEQYFAHCHGHPKKPLEIYMFVDPLCPECWSLEPVIKKLKIRYGRFFTLRIIASA
SLTALNKKRKKHLLAEAWEKIASRSGMSCDGNVWFEQDQPLSSPYMAALAFKAAELQGRK
VGMQFLRNMQESLFVSKKNITDENVLLEIAEKTSLDLEEFKNDLHSQSAVKALQCDMRIA
AEMDVSVNPTLTFFNTQHEDEGLKVPGSYSYDVYEEILFEMLGDEPKPSETPPLECFIEY
FRFVASKEIALVYDLSLEEVEKEMKKLAFAKKVAKVEAKHGMFWKSLSTYSDEYQSCEK
Download sequence
Identical sequences A0A0K6KCI4 A0A0K6LKD9 A0A0M0L0L8 G4NWF7
gi|350265437|ref|YP_004876744.1| WP_014113378.1.30885 WP_014113378.1.34242 WP_014113378.1.71834 WP_014113378.1.7204 WP_014113378.1.83369 WP_014113378.1.93618 WP_014113378.1.95507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]