SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|350265722|ref|YP_004877029.1| from Bacillus subtilis subsp. spizizenii TU-B-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350265722|ref|YP_004877029.1|
Domain Number 1 Region: 5-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-57
Family Glutathione peroxidase-like 0.00000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|350265722|ref|YP_004877029.1|
Sequence length 180
Comment peroxiredoxin [Bacillus subtilis subsp. spizizenii TU-B-10]
Sequence
MAERMVGKQAPRFEMEAVLASKEFGKVSLEENMKNDKWTVLFFYPMDFTFVCPTEITAMS
DRYDEFEDLDAEVIGVSTDTIHTHLAWINTDRKENGLGQLKYPLAADTNHEVSREYGVLI
EEEGVALRGLFIINPEGELQYQTVFHNNIGRDVDETLRVLQALQTGGLCPANWKPGQKTL
Download sequence
Identical sequences A0A063XBB7 A0A0K6KFR6 A0A0M0L1C2 A0A0T8PY85 A0A125UHB7 A0A199WGS1 A0A1V4FRB7 A0A1X7DBT1 A0A1Y0WS87 A0A285JX36 D4FW02 G4NVN9 L8AKM4 M4KR71 O34564 U1YWL9
gi|16078486|ref|NP_389305.1| gi|428279001|ref|YP_005560736.1| gi|449094119|ref|YP_007426610.1| gi|472329948|ref|YP_007662224.1| gi|350265722|ref|YP_004877029.1| NP_389305.1.22788 WP_003245371.1.100042 WP_003245371.1.101301 WP_003245371.1.11088 WP_003245371.1.11231 WP_003245371.1.11257 WP_003245371.1.1140 WP_003245371.1.11581 WP_003245371.1.12759 WP_003245371.1.1358 WP_003245371.1.14761 WP_003245371.1.15902 WP_003245371.1.16291 WP_003245371.1.18944 WP_003245371.1.19261 WP_003245371.1.20099 WP_003245371.1.20502 WP_003245371.1.21045 WP_003245371.1.2546 WP_003245371.1.25531 WP_003245371.1.27371 WP_003245371.1.27372 WP_003245371.1.27612 WP_003245371.1.27660 WP_003245371.1.2914 WP_003245371.1.30885 WP_003245371.1.31028 WP_003245371.1.31100 WP_003245371.1.31260 WP_003245371.1.31786 WP_003245371.1.32219 WP_003245371.1.32420 WP_003245371.1.33285 WP_003245371.1.33846 WP_003245371.1.34242 WP_003245371.1.34621 WP_003245371.1.35833 WP_003245371.1.36189 WP_003245371.1.3747 WP_003245371.1.39562 WP_003245371.1.39605 WP_003245371.1.40859 WP_003245371.1.42762 WP_003245371.1.43852 WP_003245371.1.44140 WP_003245371.1.44184 WP_003245371.1.45019 WP_003245371.1.47157 WP_003245371.1.47672 WP_003245371.1.51783 WP_003245371.1.5262 WP_003245371.1.52847 WP_003245371.1.52860 WP_003245371.1.54596 WP_003245371.1.54948 WP_003245371.1.54949 WP_003245371.1.55792 WP_003245371.1.56274 WP_003245371.1.56411 WP_003245371.1.57156 WP_003245371.1.57184 WP_003245371.1.57201 WP_003245371.1.5726 WP_003245371.1.57513 WP_003245371.1.6139 WP_003245371.1.6517 WP_003245371.1.65188 WP_003245371.1.65223 WP_003245371.1.67028 WP_003245371.1.69439 WP_003245371.1.71402 WP_003245371.1.7159 WP_003245371.1.71834 WP_003245371.1.7186 WP_003245371.1.71916 WP_003245371.1.7204 WP_003245371.1.72152 WP_003245371.1.72516 WP_003245371.1.72999 WP_003245371.1.74782 WP_003245371.1.76814 WP_003245371.1.76977 WP_003245371.1.78686 WP_003245371.1.78811 WP_003245371.1.79046 WP_003245371.1.79288 WP_003245371.1.79633 WP_003245371.1.79712 WP_003245371.1.79987 WP_003245371.1.80832 WP_003245371.1.81116 WP_003245371.1.81747 WP_003245371.1.82722 WP_003245371.1.83369 WP_003245371.1.84183 WP_003245371.1.84434 WP_003245371.1.84556 WP_003245371.1.88042 WP_003245371.1.88382 WP_003245371.1.88591 WP_003245371.1.89000 WP_003245371.1.90830 WP_003245371.1.91133 WP_003245371.1.91723 WP_003245371.1.92915 WP_003245371.1.93073 WP_003245371.1.93420 WP_003245371.1.93618 WP_003245371.1.94199 WP_003245371.1.95009 WP_003245371.1.95211 WP_003245371.1.95507 WP_003245371.1.96043 WP_003245371.1.97264 WP_003245371.1.979 WP_003245371.1.99091 WP_003245371.1.99399 gi|560128508|ref|YP_008829649.1| 224308.BSU14220 gi|430757848|ref|YP_007209878.1| gi|402775664|ref|YP_006629608.1| gi|321315180|ref|YP_004207467.1| gi|470161599|ref|YP_007533374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]