SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|350267561|ref|YP_004878868.1| from Bacillus subtilis subsp. spizizenii TU-B-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350267561|ref|YP_004878868.1|
Domain Number 1 Region: 44-216
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.71e-38
Family DsbC/DsbG C-terminal domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|350267561|ref|YP_004878868.1|
Sequence length 222
Comment disulfide bond formation protein D [Bacillus subtilis subsp. spizizenii TU-B-10]
Sequence
MKKKQQSSAKFAVILTVVVVVLLAAIVIINNKTEQGNEAVSGQPSIKGQPVLGQDDAPVT
VVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKE
DPDSFWAFHEKLFEKQPDTEQEWVTPAVLGDLAKSTTKVKPETLKDNLDKETFASQVEKD
SDLNQKMNVNATPTIYVNDKVIKNFADYNEIKETIEKELKGK
Download sequence
Identical sequences A0A0M0KT77 G4P0Q7
WP_014115153.1.83369 WP_014115153.1.95507 gi|350267561|ref|YP_004878868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]