SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41614823|ref|NP_963321.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614823|ref|NP_963321.1|
Domain Number 1 Region: 6-59,152-310
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000356
Family Bacterial dinuclear zinc exopeptidases 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41614823|ref|NP_963321.1|
Sequence length 314
Comment hypothetical protein NEQ028 [Nanoarchaeum equitans Kin4-M]
Sequence
MKKSKLNYSELNSIYKDLVFFDSNYIRKTLHRADYIEQFLDKYKIDYHIYEHFVLVPDWV
KYYLYIDGQKIDVLPTGLKSGKIEKNIKDSSDLENNYNYPNINFNSYLESKTDISTPIFY
NVPSLAVSKNSINLLLNSNDVDGYLKVKIRDIKNKNFVIGNVDKAEQAIVVHYDALWYGA
IDNTSSLGLILYMLKNKEINLNKNAIFLIGFTEIAYYWPEYWDYSFIRVIEKYEDVFKKV
KRKLIIDCIGYKDTQFLTDKEYIEAYGVFGDNILIYGTPLEGLIAIYHATNDTIDKINFD
QLKKDRDSLKTFLS
Download sequence
Identical sequences Q74MG8
228908.NEQ028 gi|41614823|ref|NP_963321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]