SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41614906|ref|NP_963404.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614906|ref|NP_963404.1|
Domain Number 1 Region: 32-179
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000121
Family ATP-dependent protease Lon (La), catalytic domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41614906|ref|NP_963404.1|
Sequence length 420
Comment hypothetical protein NEQ110 [Nanoarchaeum equitans Kin4-M]
Sequence
MNSKDILIYASISSLLLMSFILFQTHRYIEINAVAITNNSAEIVPIKIEATIGQGNYVNL
NSYIDNNFQYSIKMSDEFIKSIGIENIYQYKISFESNSYYSSGSSAGLALTIGKLLLITA
PHFDVRNYVFTGVILPFGIIGAVSGIDKKYEAVLKNNKTLIHGNENFKKGLYFNNVFEVY
KFITKRDLAKKHKLKIPEWYNKIMREITLELCNKTESIAPNSKEFQKALEAIKKGHYYSA
ASFCFIANYKYDKNHTKLEIAEEIREIKKKIEKIKNKVLTIYDAEALGMALDRLKDAEQN
INNTSYSYWRLQTVKGWLKFVGNTTGIKNYCPNMDLSTYYIYYPFETKINKLTCYYDVEK
TLFKVYATVLLTYNVSDKKLLSVLPYYQKHFSLWGYTNLEYYNYTKDKTHLIIALTSFSI
Download sequence
Identical sequences Q74ML1
gi|41614906|ref|NP_963404.1| 228908.NEQ110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]