SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41614907|ref|NP_963405.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614907|ref|NP_963405.1|
Domain Number 1 Region: 2-174
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-29
Family Ribonuclease PH domain 1-like 0.00016
Further Details:      
 
Domain Number 2 Region: 150-218
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.0000000000000785
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41614907|ref|NP_963405.1|
Sequence length 218
Comment exosome complex RNA-binding protein Rrp42 [Nanoarchaeum equitans Kin4-M]
Sequence
MHYIEQKLMDGFHIDNRPLLEYRPIKIKEDQNRVWLSLGNTQVIAGLSISEEEPMEKGKA
NLIVNADFSPIAGKEYFQGPPTEQDLILARLIDRALRSSNAIALEKHVIDENKVKSFYID
VIVLEDDGNILDASMLAVVKLLEKANLLERKPLYISFYKYKNIIFVDPTKEEEQISNAKI
SIAIDGENIVSIQKDYGSFDENEIEELIDLAFDLYKKL
Download sequence
Identical sequences Q74ML0
gi|41614907|ref|NP_963405.1| 228908.NEQ111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]