SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615022|ref|NP_963520.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615022|ref|NP_963520.1|
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.62e-17
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 66-138
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000111
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615022|ref|NP_963520.1|
Sequence length 138
Comment hypothetical protein NEQ229 [Nanoarchaeum equitans Kin4-M]
Sequence
MGRIDSIDIKILSILEENARTKFTDIAKTLNLTEAAIRKRIKKLEENQIIKRYSIDIDYK
KLGYNMAIIGLDIDMDYFPKIIKELEKRKEFLHIYSSAGDHDIMVIAIYKDLEEIYNYLK
NLKGVKRVCPAIIIDQIK
Download sequence
Identical sequences Q74NE5
gi|41615022|ref|NP_963520.1| 228908.NEQ229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]