SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615042|ref|NP_963540.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615042|ref|NP_963540.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-37
Family Ribonuclease PH domain 1-like 0.0000726
Further Details:      
 
Domain Number 2 Region: 131-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.000000000000109
Family Ribonuclease PH domain 2-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41615042|ref|NP_963540.1|
Sequence length 233
Comment exosome complex exonuclease Rrp41 [Nanoarchaeum equitans Kin4-M]
Sequence
MRFDGRDYNEIRDTEMKIGVISKADGSAYCRTGNTIAIAAVYLKPGREQSNLKVSYRMLP
FAGEERKGLGLTRREIELSYIIAKALEPAIIFEEIPYLTIEASVEIIKADAGTRVAAINA
LSLALAHAGIPMKALVGAIAVGKVGEKIVLDLNKQEEDYDSEIIKKELPQYYEYYGEGKA
VDIPMAMYKNKITLLQLDGSIDRKSLLEAIKLGKDGIKRMIDLQKIAIEDYYF
Download sequence
Identical sequences Q74NF6
gi|41615042|ref|NP_963540.1| 228908.NEQ248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]