SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615071|ref|NP_963569.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615071|ref|NP_963569.1|
Domain Number 1 Region: 54-196
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000174
Family ATP-dependent protease Lon (La), catalytic domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41615071|ref|NP_963569.1|
Sequence length 475
Comment hypothetical protein NEQ281 [Nanoarchaeum equitans Kin4-M]
Sequence
MNKSDIVILAFFFVSLGLGILTLLPANTVKETTKNQTELKVSKLKLLNVTIAKNNYFSIN
GVAVNELERKGEVTPILFKVYNSSKGTVYIDTDSYKEISFQKSIAIAKEFVKYFVRTNLD
NKDILIKLKVDSPFVAGESAGLPLTLGLIFAAKGYVPQNLDKYVFTGVIMPFGIIGEVGG
IDLKYLAATQKGKTLVHGQSTFLGGLYYTDVLSLYRDLFGIELIEKKPIKIPRWYLDITK
QLADDLCKKAIEHGFKDSKEYKVYEKAYKNKDYYAAASLCFKYLYDNVPIDTDVYSLILE
TRKELNDAIKKAKTLYDAEAIGAARERLRIVIELYNKYLDTGNKEFLYKAYWRLQTVKGW
LKFVGNTTGIKNYCPKEVVNEINKIYSAFIGETVEIPNSIDCYYLAKEYISNLHYRLFSY
PSNVFALIKIAPYYFDRFDLVGYSYYQLSKYLNEDKLLYIIKAIDFSHNYLTNNS
Download sequence
Identical sequences Q74MT9
gi|41615071|ref|NP_963569.1| 228908.NEQ281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]