SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615082|ref|NP_963580.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615082|ref|NP_963580.1|
Domain Number 1 Region: 2-171,238-368
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.04e-55
Family tRNA pseudouridine synthase TruD 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|41615082|ref|NP_963580.1|
Domain Number - Region: 189-239
Classification Level Classification E-value
Superfamily YqgQ-like 0.0706
Family YqgQ-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615082|ref|NP_963580.1|
Sequence length 374
Comment hypothetical protein NEQ293 [Nanoarchaeum equitans Kin4-M]
Sequence
MRIKEKPEDFVVIEKTNFSIAEPSKYYDQFKFMGIKDNGIPGDYTIYVLKKKNLSTTQAI
KIIAKQFRLSKYRISFSGEKDKKAITYQLISIYKGPKKSMFLDNLELYYIGLSDKPVKLG
SHLGNYFEIKVYAESPKGFDVFPNYFDVQRFGDKRLVNHLIGKHLIKNECEEAAKILLTF
VGKESKKTIKVRQLIKEYWNNIEKLKKVIPLMPKALDIEKAYLQSFIEKKDYCKAFKAIP
KWILMLFIHSYQSYIFNETLKMYLKNKTKIIKIRDLLEFYFADYYENIEIPLIGYKVNAK
GEIKEIIDYLLDKEGITIEMLKNKKVVGTYRKGFQKMYDLKIKKNQKWLTKFYLEKGSYA
TVAIRSLFLEPIDF
Download sequence
Identical sequences P60348
228908.NEQ293 gi|41615082|ref|NP_963580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]