SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41615098|ref|NP_963596.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615098|ref|NP_963596.1|
Domain Number 1 Region: 212-477
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.12e-62
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000705
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.41e-23
Family Seryl-tRNA synthetase (SerRS) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41615098|ref|NP_963596.1|
Sequence length 484
Comment seryl-tRNA synthetase [Nanoarchaeum equitans Kin4-M]
Sequence
MIDVEFLRKYPEKYKEMLKKRFMDTSIVDEFLAYDNLWRSLKKELDNLRCLHNAISKAIA
TGKLEHNCNTKIELKDDKEYLITLAKSLKKEIEILEKQLKEIESKRNDILWRMPNYIRED
VPIGEDERYNKPLKYWGVAKVLDVEKFKQETQRKPINILELDPRYIKDSLTYKELIDFLR
STNPEYFVNPDEAIDFDLLNKEGLVLYIKIDKAKHHYDLTKELNIADQELGSKIAGSRFY
VEFEKGLFMELKLIKFVLETLKSRTEGKYNYKIMKLPYLVRGWVEKAAAYFTAFEDTLYK
IEGEDLYLNPTAEHPIAGLYKDYYFNDNELPLIVYGFTTAFRKEAGSHGKDTKGIFRVHQ
FEKIEQYAFTTKEQLLEIYNFLVSNAETIVKKLGLPYRIVFNSSGDMDKKVTMQWDLEVY
YPAQEKYRELHSFGTVEEWQARRLNIKYSKGYVNTIYATALPIQRAMTALLENNLFELNY
NRLK
Download sequence
Identical sequences Q74NI2
228908.NEQ308 gi|41615098|ref|NP_963596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]