SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615175|ref|NP_963673.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615175|ref|NP_963673.1|
Domain Number 1 Region: 7-116
Classification Level Classification E-value
Superfamily Prefoldin 1.15e-18
Family Prefoldin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41615175|ref|NP_963673.1|
Sequence length 121
Comment hypothetical protein NEQ385 [Nanoarchaeum equitans Kin4-M]
Sequence
MDLREKYLLFEELTKEYEVILNRVAELELAIEYLKELRDGNGLILFNGLLIKGEAKETNK
VIVPVGAKYYVEIDKDKAIEKMAKQLDSLKIEAEKLKNDIDKIKDELKEELAKLQQNNIA
V
Download sequence
Identical sequences Q74MD6
gi|41615175|ref|NP_963673.1| 228908.NEQ385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]