SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615186|ref|NP_963684.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615186|ref|NP_963684.1|
Domain Number 1 Region: 2-191,259-283
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-49
Family Creatinase/aminopeptidase 0.00000835
Further Details:      
 
Domain Number 2 Region: 188-261
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000725
Family Methionine aminopeptidase, insert domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41615186|ref|NP_963684.1|
Sequence length 284
Comment methionine aminopeptidase [Nanoarchaeum equitans Kin4-M]
Sequence
MDIDKILEAGRIAKEAREYAQKLCKSITDGLELAIKVEEFIKKRAKLAFPVNVSIHNVAA
HFSPIEPIEMYGVVKIDLGANVDGYLSDTAFSCDLDGNYEELVEASKKALENASKIMRYG
VTLSEIGKTIEETIKSYGFNPIKNLTGHSIEYNQLHGGLYIPNYDNGDKTIIKEGLYAIE
PFATMGKGYVRNGPPSNIYILVKPKRVRDIRARKVLQYIIENYGWLPFAKRWLIEEFGPI
DRELYYLLKEGIIYSYPQLIEEKPVSQFEHTFLVLKDKTIITTL
Download sequence
Identical sequences Q74N19
228908.NEQ399 gi|41615186|ref|NP_963684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]