SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615231|ref|NP_963729.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615231|ref|NP_963729.1|
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.02e-29
Family Translational machinery components 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615231|ref|NP_963729.1|
Sequence length 136
Comment 30S ribosomal protein S9P [Nanoarchaeum equitans Kin4-M]
Sequence
MKHLVVSAKRKTSIARAYFREGNGIIRINGFLLEVWQNPLARARVKEPLIIAENIIPGIT
KEIDINVNVFGGGWHSQTEAVRQAIARGLVVWTGSDQLKKAFLEYDNWLLVNDPRRKEQN
KSLRSKPRAWRQTSYR
Download sequence
Identical sequences Q74M88
228908.NEQ446 gi|41615231|ref|NP_963729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]