SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615241|ref|NP_963739.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615241|ref|NP_963739.1|
Domain Number 1 Region: 3-138,173-243,278-426
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.1e-78
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000267
Further Details:      
 
Domain Number 2 Region: 676-775
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.3e-33
Family Myf domain 0.0000154
Further Details:      
 
Domain Number 3 Region: 432-581
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 9.35e-29
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000712
Further Details:      
 
Domain Number 4 Region: 139-173
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00000000000288
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41615241|ref|NP_963739.1|
Sequence length 776
Comment hypothetical protein NEQ457 [Nanoarchaeum equitans Kin4-M]
Sequence
MRILVTAALPYSNGPIHLGHIAGAYLPADIFYRFVKLKGYNALYICGSDQYGSPIELNAI
KLNIDPKDYASFYRKIQEEIFKKFNIKFDIYSGTAESNIHPIIVKEFFLSLFSAGLLIEK
EQELPYDPKIKRFLPDRFVVGQCPYCGYEKAYGDQCEKCGRLLEPKELINPKSAITGEKV
IFKKTRHLFFNIPKLKDKLKQYIESKKDVWNDFTYSWSLALLDNFKERAITRDNKWGVKV
PAKEMLEILKKALKEGKTPKDFGLLIDSTNEKDLENHIKEYENKVLYVWFDAPIGYISFT
FETSPEYRYYWDEKEKPYIVHFIGKDNIPFHTIFWPALIIGRNLGYKNINHILDFDIALP
YQVFGNPYLNYYGKKFSKSKRWGVFLDNIDKIDIDIDYFRFYLAYIHTVSKDMSFEWDQF
KEVINKELVDNIGNFIHRVLTFIYNRFNGIPPKIEHLDDKDKELLDKIKQLPEKVFNFIW
KGEIGNALREIVNTSNLANKYFQEKEPWKTNDPNTIAIAFEAVKTFIILLYPFIPEKAKL
LASIANIDIKWDFNQKVEKINKPFIVFHKLSDNQIEMAKQILTNPKEYDLGKKKVIGVLR
YEDELYKIELECDDNPWVCLKRELDKRKIKYIYDTVKGDVPPHIIDGNTYIYLLPALEKP
NLEKAEEEYGLVSYLDFAKLDMRVGKIIDVQDHPNADKLYIIKVSLGNKQKTLVGGLKQY
YKKEELIGKYVVLINNLKPKQLRGITSEGMLLAADDGKEVALLMPDKPISLGSKVR
Download sequence
Identical sequences Q74MZ1
gi|41615241|ref|NP_963739.1| 228908.NEQ457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]