SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615293|ref|NP_963791.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615293|ref|NP_963791.1|
Domain Number 1 Region: 5-161,290-370
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.2e-47
Family Bacterial dinuclear zinc exopeptidases 0.0018
Further Details:      
 
Domain Number 2 Region: 162-283
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.79e-17
Family Bacterial exopeptidase dimerisation domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41615293|ref|NP_963791.1|
Sequence length 372
Comment succinyl-diaminopimelate desuccinylase [Nanoarchaeum equitans Kin4-M]
Sequence
MIDMDFFLQLLKFKTFNPNKEEKEKAAKFIKNYLENKGFDVEIIYSENDTPNILAKYPGK
GKKVAFVTHFDVVPPGEGWNTDPFDPKVEGNKIIARGAADDKSAIVASIAGIENAKEINV
QPILAIAGGEETQESTQFFEQIDSDIALVIDTGPYVSIGSSGFLGINIYVEGKQVHSAHA
YRGENAIYNAAKVIEFIEHISKAFEKTLLSKYQFIEHYDRVPVRVNPTKIEVKPNVINII
PGEVKIYVNARTVPEYDNDYVFNKVSDLLKEFASKNNIKLRIEKDKLELPPWVSDGEHVD
KFIQLTKDLLGEKKILELGGTDGYHFYKRGIKVIQFGPMREENNIHGPNEFVYIEDVERV
AEVIKRVVENGL
Download sequence
Identical sequences Q74M62
gi|41615293|ref|NP_963791.1| 228908.NEQ511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]