SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615298|ref|NP_963796.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615298|ref|NP_963796.1|
Domain Number 1 Region: 8-81
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000000275
Family Prefoldin 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615298|ref|NP_963796.1|
Sequence length 83
Comment hypothetical protein NEQ516 [Nanoarchaeum equitans Kin4-M]
Sequence
MAEKEVLLQQILMQKQVLEAQLEEINNAIKEIEESNGKVYKILGTYFLEIPKEKALEELN
EKKKLLEIRLDALKKQEEKLKGE
Download sequence
Identical sequences Q74MX1
gi|41615298|ref|NP_963796.1| 228908.NEQ516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]