SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41614939|ref|NP_963437.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614939|ref|NP_963437.1|
Domain Number 1 Region: 316-475
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.46e-56
Family DNA gyrase/MutL, second domain 0.0000191
Further Details:      
 
Domain Number 2 Region: 10-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.17e-30
Family DNA gyrase/MutL, N-terminal domain 0.000029
Further Details:      
 
Weak hits

Sequence:  gi|41614939|ref|NP_963437.1|
Domain Number - Region: 224-309
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00671
Family Topoisomerase VI-B subunit middle domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41614939|ref|NP_963437.1|
Sequence length 567
Comment DNA topoisomerase VI subunit B [Nanoarchaeum equitans Kin4-M]
Sequence
MRRTFREATIAEFFEKNKQFLGFDSPRKALVMTVKELVDNALDATEEARILPTIKVTLKE
GKYMTVRVEDNGPGIPFNEVPNVFGKFLYGTKFHVLKQNRGQQGIGAAAITLYSQLTTGK
PIRVWDKPIDSNKAYYYEIMIDTKRNEPEVLVKKEVKLNIKHGLIVEADIKGEYTKGKQS
VDQYLKLTAVANPHAEIIYRTPKGEYIVFKRGTNELPPLPKEIKPHPHGIELGQLKKMVS
EHKGDLMDFLIKNFSSVGEDKAKEILARYIFYKEGKEDFEKFFKRFRGRKIDIKSLTSED
LELLLKAMRETKLKMPSAKALIPIGEKNLQIGITKEYDVEYLAVKTRKPKVYSGGIPFLV
EVAIGYGDFEKAEILRFANRTPLLYKAGECAIVKAIKDINWKRYGFEVENNLPKNALILV
HIASVKVPYTSESKEAIADIPEVREEIKRALQEVARKVQIYIKKKEETKELAEKYLRFYA
YGKEIERYLPKLIDKDVDSVVTKTILKRLEEELLERIKNNKTIVTHIENKDYETAKKLIK
KMVMPLIKKKIIDESFIDRLIQLYNVS
Download sequence
Identical sequences Q74N98
gi|41614939|ref|NP_963437.1| 228908.NEQ144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]