SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615139|ref|NP_963637.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615139|ref|NP_963637.1|
Domain Number 1 Region: 426-592
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-43
Family ATP-dependent protease Lon (La), catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 14-81,189-400
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.98e-34
Family Extended AAA-ATPase domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41615139|ref|NP_963637.1|
Sequence length 600
Comment ATP-dependent protease Lon [Nanoarchaeum equitans Kin4-M]
Sequence
MPMDFKTTEEIKVPKKLIDQIIGQDKAVKLAKMAIQNRRHLLLIGPPGTGKSMLAKAMAE
LLPKEGLEDFLAFPNPKDEFQPIIKTVPAGEGKKIVERSKIAALNALKGKNQLTAIIALI
ALLMPFYFYYTGEKILAAASMIMSSILLVGLSLGFNVMNKRKLLESIPKLLIDNSDKKHA
PFVDATGANPSQLFGNVLHDPFQSGGLETPAHHRVVPGLIHKAHKGVLFIDEIATLPWDV
QYELLVAMQEKKYPIFGRDERSGGSIVRTTPAPCDFILVAAGTEEAIKNMHPALRSRIKG
NGFEVYMNEDMPDTPENREKLARFVAQEIMRDGKIPHFTRDAVEEIINIAKKLAGREGYL
TLRLRELGGYVRLAGDIAKSKGKKYVTKEDVIEAERIGQSIEEQIVERIKELRRRYDIVI
KEGYEIGRANGIGVIGNKGVIIPIDVNVAYGNGKIITSGILGKIAEQAIKTIEGYVKSVF
GKDIKEYDIYVQFVQTYEEIEGDSASLAIALATISALTKTPLDQSFVITGSIDVKGRVLP
VGGIIPKIEGAIEEGFKNIIIPKQNLKDVPKEYFNNINIYGVSTIDEALNLVGAKPDKKL
Download sequence
Identical sequences Q74NJ8
228908.NEQ349 gi|41615139|ref|NP_963637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]