SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615282|ref|NP_963780.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615282|ref|NP_963780.1|
Domain Number 1 Region: 61-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-29
Family Clostridium neurotoxins, the second last domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615282|ref|NP_963780.1|
Sequence length 356
Comment hypothetical protein NEQ500 [Nanoarchaeum equitans Kin4-M]
Sequence
MRSITPIIAIVILLLVTISAVTPLYLWVQKGVQKYSQKATKTADTTFKSITNLEIADIKI
YKKYDGALALWYLDEGFGNIVDDYSNNNYKLKFEGSPRWVKGVLSNALEFNGNSSLKGNY
QLLVGKTKWSITLITKPYSLANYTYAEGTTDGDKIVLEIANNKFRIAISNNSVGWQRLSS
SLPLSKNEWYFVAVTYDGDNLKICVNNVCNSTSGIKSATTGGGTVKIANGVYANYPYKGV
IDEIYLYNEPLDNKTIENLYYRLTVRVVNPNDRPIKIEGYYQIEDPETGNIICEIPLKYK
ETFITDSGSDLIKPSKEETIRMVLFYKDKHCSLNKWKTYNFCLTNGINRVCKLFHP
Download sequence
Identical sequences Q74MW2
gi|41615282|ref|NP_963780.1| 228908.NEQ500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]