SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41615324|ref|NP_963822.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615324|ref|NP_963822.1|
Domain Number 1 Region: 9-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.8e-67
Family G proteins 0.00000387
Further Details:      
 
Domain Number 2 Region: 476-640
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.4e-36
Family Translational machinery components 0.00044
Further Details:      
 
Domain Number 3 Region: 263-382
Classification Level Classification E-value
Superfamily Translation proteins 6.85e-29
Family Elongation factors 0.0019
Further Details:      
 
Domain Number 4 Region: 642-735
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.49e-24
Family EF-G/eEF-2 domains III and V 0.0015
Further Details:      
 
Domain Number 5 Region: 400-476
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.47e-21
Family EF-G/eEF-2 domains III and V 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615324|ref|NP_963822.1|
Sequence length 743
Comment elongation factor EF-2 [Nanoarchaeum equitans Kin4-M]
Sequence
MVSEKTMAERVLALMGRPNNIRNIGIIAHIHHGKTTLTDNLLAGAGMLSEELAGDAMFTW
WHEQEREREMTIYGAAVSMVHEYEGDDYLINLIDTPGHVEFGGEVTRAVRAIDGAVVVVD
FVDGIMPQTETVLKQALREYVKPVLFINKVDRAIKELQLPPNKIMERLAEIVVGVNDLIE
RYAPEEFKDKWKVSVQNGTVAFGSALHNWALSVPYMQKTGIGFKQIAEIYNTAADAKEIR
RRVWEIAPLYRVVLDMVVRHLPSPKEAQKYRVPKLWHGDLNSKYGKAMLEADPNGPAVAV
VTKVIVDKTSKQETAIARVWSGTIRRGMEVWLLNANKKVRLQQVGVFKGIQKIQIEEAKA
GNIIAISGVRDLQSGETIVEPEPDGSKPNIPPFEAIKHIFDPVVTKAIEPKDPRDLPKLI
EVLKLIQKEDPTLKVEIDQESGQILISGLGDLHLEIVEYRIKNDFKVDIITSNPIVVYRE
SVKGQAGPVEGKSPNKLNKFYITVEKMPDELYWKLREKLLKGELPEGKIKKMNEDIIKHL
MSLGFTREEAQRCKVIYRENMFFDMTRGIIHIGEVIDMVMDAFMQVMDHGPIAWEPCIGL
IVKLTDAQLHEDAIHRGPGQVIPAVREAIKLAMKDAGLVLYEPVQVILVDVPPDYIGDVT
ALINSRRGAILDIQTEEDRALIKAKVPVREMIGFTDTLRSATSGRGVWYLVDQVYEPVPR
ELFDQIVREIRQRKGLPLDADIV
Download sequence
Identical sequences Q74M52
228908.NEQ543 gi|41615324|ref|NP_963822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]