SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001003291.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001003291.1.84170
Domain Number 1 Region: 28-108
Classification Level Classification E-value
Superfamily Immunoglobulin 9.39e-25
Family I set domains 0.00036
Further Details:      
 
Domain Number 2 Region: 211-307
Classification Level Classification E-value
Superfamily Immunoglobulin 1.79e-24
Family I set domains 0.00019
Further Details:      
 
Domain Number 3 Region: 107-201
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-23
Family C2 set domains 0.0000138
Further Details:      
 
Domain Number 4 Region: 390-475
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000294
Family I set domains 0.00021
Further Details:      
 
Domain Number 5 Region: 308-390
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000398
Family C2 set domains 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001003291.1.84170
Sequence length 531
Comment intercellular adhesion molecule 1 precursor [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MAPGPAAPALPALLALLGALLPGLGGAQTSVDPAEAIIPRGGSVQVNCSTSCNQTSIFGL
ETLLTKKELNSGDNWVLFELTDVQEDSKLICFSNCHEQTMAPMHLTVYWFPERVELAPLP
RWQPVGENLTMTCQVAGGAPRTNLTVVLLRGEEELSRQPAVGEPAEVTFTVAVGREDHLA
NFSCRTDLDLRHRGLGLFQNSSAPRQLQTFVLPETPPRLATPPIVEVGTQWSVDCTLDGV
FPASEAQVHLALAEERLHSTVLYKKDSLLATANVKANPEDEGTQQLWCEVTLGDENRRWQ
ENVTFYSFPAPNLTLSEPEVSEWTTVTVECEAPAGVVVSLSGLPSGLAVPRAQFQLNASA
ADNRRSFSCSAALEVAGHMLQKNQTRELHVLYGPRLDQRDCPGNWTWEEGSHQTLKCQAW
GNPVPELKCHRKGDDALLPIGDLRPVKREVAGTYLCQARSPRGEITREVVINVIYHQNNI
LIIILVTTIVILGTVSVAAYLYNRQRKIQKYKLQKAQEAAAMKLNTPATPP
Download sequence
Identical sequences F1PB95
ENSCAFP00000026375 NP_001003291.1.84170 ENSCAFP00000026375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]