SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001007847.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001007847.1.86415
Domain Number 1 Region: 12-121,162-188
Classification Level Classification E-value
Superfamily SH2 domain 7.67e-25
Family SH2 domain 0.00000899
Further Details:      
 
Domain Number 2 Region: 132-228
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-24
Family SH3-domain 0.0000382
Further Details:      
 
Domain Number 3 Region: 216-301
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000174
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001007847.1.86415
Sequence length 305
Comment adapter molecule crk [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MAGQFDSEDRGSWYWGRLSRGDAVSLLQGQRHGTFLVRDSGSIPGDFVLSVSESSRVSHY
IVNSLGPAGGRRAGGEGPGAPGLNPTRFRIGDQEFDSLPSLLEFYKIHYLDTTTLIEPVS
RSRQNSGVILRQEEVEYVRALFDFNGNDDEDLPFKKGDILKIRDKPEEQWWNAEDMDGKR
GMIPVPYVEKCRPSSASVSTLTGGNQDSSHPQPLGGPEPGPYAQPSINTPLPNLQNGPFY
ARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQQNP
DEDFS
Download sequence
Identical sequences Q04929
ENSGALP00000004174 ENSGALP00000004174 NP_001007847.1.86415 XP_015151517.1.86415 9031.ENSGALP00000004174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]