SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001008613.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001008613.1.45394
Domain Number 1 Region: 9-154
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 1.2e-50
Family Troponin I 0.00000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001008613.1.45394
Sequence length 182
Comment troponin I type 1b (skeletal, slow) [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MPEQEKKSKISASRKLMLKSLMVAKAKEELEQELADKEDEKEKYLSEKAPQLQTSGMSFA
ELQELCRELHAKIDVVDEERYDIEAKVLHNTREIKDLNIKVLDLRGKFKRPTLRRVRVSA
DAILRSLLGSKHKVSMDLRANLKSVKKEDTEKEKTVEVSDWRKNVEAMSGMEGRKKMFDA
AQ
Download sequence
Identical sequences Q5PR62
ENSDARP00000109710 ENSDARP00000124141 NP_001008613.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]