SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001012206.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001012206.1.100692
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000112
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001012206.1.100692
Sequence length 125
Comment pleckstrin homology-like domain family A member 3 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MTAAATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFSRIKAVE
CVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGT
GTLVS
Download sequence
Identical sequences Q5PQT7
ENSRNOP00000011999 10116.ENSRNOP00000011999 NP_001012206.1.100692 NP_001012206.1.4139 ENSRNOP00000011999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]