SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001017071.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001017071.1.99540
Domain Number 1 Region: 9-67
Classification Level Classification E-value
Superfamily RING/U-box 1.61e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001017071.1.99540
Sequence length 168
Comment E3 ubiquitin-protein ligase RNF5 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MAAAAGSPGAAYECNICLETAREPVVSVCGHLYCWPCLHQWLETRPDRQECPVCKAGISR
EKVIPIYGRGDSNQKDPRLKTPPRPQGQRPEPENRAGGGVPGFTDTGFHMSFGIGAFPFG
FFTTVFNTNDLHSAPRADTGLPQSRFFGLPDSLFLIIAAFFFLWLISV
Download sequence
Identical sequences Q07G61
ENSXETP00000020841 NP_001017071.1.99540 gi|115530756|gb|CAL49360| gi|62858735|ref|NP_001017071| ENSXETP00000020841 8364.ENSXETP00000020841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]