SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001023684.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001023684.1.50509
Domain Number 1 Region: 19-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001023684.1.50509
Sequence length 95
Comment Uncharacterized protein CELE_C27A7.9 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MCRLTILVLSAVLFAAVHSQNCTWSNWAAWTTCSDSCGNCGNQTRARSCSSQTASCICTG
NTTELQTCNNDVCIFPRKSCCSGQPASLQGFFKCS
Download sequence
Identical sequences Q7YTR5
6239.C27A7.9 C27A7.9 NP_001023684.1.50509 C27A7.9 C27A7.9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]