SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001025064.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001025064.1.92730
Domain Number 1 Region: 156-260
Classification Level Classification E-value
Superfamily Immunoglobulin 3.97e-23
Family V set domains (antibody variable domain-like) 0.00062
Further Details:      
 
Domain Number 2 Region: 275-380
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-22
Family V set domains (antibody variable domain-like) 0.00042
Further Details:      
 
Domain Number 3 Region: 36-140
Classification Level Classification E-value
Superfamily Immunoglobulin 8.03e-21
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 
Domain Number 4 Region: 392-473
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-17
Family I set domains 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001025064.1.92730
Sequence length 475
Comment pregnancy-specific glycoprotein 26 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEVSSELFSNGCTSWQRVLLTASLLTCWFLPTTARVTIESLPPQVVEGENVLLRVDNMPE
NLLVFGWYRGMTNLRQAIALHSLYYSVTVKGLKHSGRETLYINGTLWIQNVTQEDTGYYT
FQTISKQGEMVSNTSLYLHVYSSLFICGRPTTLVGPTIELVPASVAAGGSVLLLVHNIPK
YLQSLFWYKGLIVFNKVEIARYRRAKKSRESGPAHSGRETVYSNGSLLLQNVTWKDTGFY
TLRTLTRYQKMEFAHIYLQVDTSLSLCCDTLDSAQLSIDPVPQHAAEGGSVLLQVHNLPE
GLQAFSWYKGVLSTQDFKIAEYSIATKSIIRGRAHSRREIGYTNGSLLLQDVTEKDSGLY
TLITIDSNVRILTAHVQVNIHKLVTQPAMRVTDSTVRVQSSVVFTCFSYNTGISIRWLFN
NQSLQLTERMTLSPSKCQLRIHTVRKEDAGEYQCEAFNPVSSKTSLPVRLTVMNE
Download sequence
Identical sequences Q4KL65
NP_001025064.1.92730 ENSMUSP00000092392 ENSMUSP00000092392 ENSMUSP00000092392 10090.ENSMUSP00000092392 NYSGRC-IgSF-NP_001025064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]