SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001025251.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001025251.2.45394
Domain Number 1 Region: 29-139
Classification Level Classification E-value
Superfamily SH2 domain 1.52e-30
Family SH2 domain 0.0000796
Further Details:      
 
Domain Number 2 Region: 155-212
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000759
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001025251.2.45394
Sequence length 214
Comment GRB2-related adaptor protein [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MEAEALYSFRATECDELSFQKGEILKVTNMDDDPNWYTAELLGRRGYVPKNYINVRPHTW
FVGGISRQAAENRLRPLECGAFLIRESESTPGEFSVSVSYGDHVQHFKVLKDGLGQYFIW
DEVFSSLNQLVDFYRINSIAKERTVFLREPEGSLARPRHAHAIFDFTSNHVTHLRFLRGD
VIDLLDCSDAQCWRGRCRGRVGIFPPEYVQPIYH
Download sequence
Identical sequences F1QSQ4
NP_001025251.2.45394 ENSDARP00000075536 ENSDARP00000075536 ENSDARP00000122058 7955.ENSDARP00000075536 7955.ENSDARP00000094385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]