SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001028111.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001028111.1.72884
Domain Number 1 Region: 24-202
Classification Level Classification E-value
Superfamily TIMP-like 5.1e-73
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001028111.1.72884
Sequence length 207
Comment metalloproteinase inhibitor 1 precursor [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAPFEPLASGILLLLWLIAPSRACTCVLPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT
TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK
GFQSRHLACLPREPGLCTWQSLRTRMA
Download sequence
Identical sequences A0A2K5WNU0 A0A2K6CAR0 H9FZ30 Q95KL9
NP_001028111.1.72884 XP_005593482.1.63531 XP_011709616.1.29376 9544.ENSMMUP00000014993 ENSMMUP00000014993 ENSMMUP00000014993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]