SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001029971.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001029971.1.59421
Domain Number 1 Region: 254-280
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0000235
Family Moesin tail domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001029971.1.59421
Sequence length 282
Comment ermin [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MTDVPVTFSQVECNGDTPPENGQQKITKITEGASDVDGTPPHCRVEPRLDVPTERNQEKS
EKLQEDILLSSSMDEKILKEKPEEKLYVVHKALTDLSLQEAAVDKMALREGHQWEKIPLS
SSNQEISRQKERISEQPLEEREDEELENTALQATEIEWLGFQKSSQVDLSHSKQDEEQEV
WDEEINNDDDDDCKDDEDEVRVIEFKKKNEEDTQLKEEGDASEDSPLSSPSSQPVTPDEQ
PTFGKKGDFSRNAYSRYNTISYRKIRKGNTKQRIDEFESMIN
Download sequence
Identical sequences Q3ZBR9
NP_001029971.1.59421 NP_001029971.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]