SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001031203.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001031203.1.80155
Domain Number 1 Region: 100-191
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.2e-25
Family C1-like domain 0.029
Further Details:      
 
Domain Number 2 Region: 213-240,267-329
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.91e-18
Family C1-like domain 0.067
Further Details:      
 
Weak hits

Sequence:  NP_001031203.1.80155
Domain Number - Region: 38-67
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001031203.1.80155
Sequence length 343
Comment Cysteine/Histidine-rich C1 domain family protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MDMYEYEISRIPRVKIPCSHPLVSWWLMHTGSGDPHEYLPCDGCGDTEGNAIYCKICKFR
AHFECIIQPDIINHPCHSKHPLKKVLAETIDYTDGNCHFCRSPLDEVMYHCSICNISIDL
SCWIYPPPLTIYQPKSHNHTFTLMARKDSFTCNACGLVGDRNPYVCLECDFMLHKDCIDL
PRVININRHDHRISRTYHLGQGDWECGVCRKQIDWTFGGYSCKRCPSYAVHSKCATRGDV
WEGEELEDEPEEEEIEDPYKVIDEKEILHFSHEHNLRLGDDNAADNEKCHACVFPINSDP
FYQCVQCKFLLHKVCATLPRKKRNILHNHKLDLQIQGKPGEVF
Download sequence
Identical sequences Q2V4G4
NP_001031203.1.80155 AT1G58037.1 3702.AT1G58037.1-P AT1G58037.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]