SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001035241.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001035241.1.87134
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000157
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001035241.1.87134
Sequence length 215
Comment sodium channel subunit beta-3 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE
Download sequence
Identical sequences A0A024R3H7 A0A2K5F6M1 A0A2K5PLK5 F7I734 G3QXH2 H2NG18 H2Q503 Q9NY72
ENSPTRP00000007545 ENSPPYP00000004704 9598.ENSPTRP00000007545 9600.ENSPPYP00000004704 9606.ENSP00000299333 ENSP00000299333 ENSP00000376523 ENSP00000432785 ENSPTRP00000007545 ENSPPYP00000004704 NP_001035241.1.87134 NP_001035241.1.92137 NP_060870.1.87134 NP_060870.1.92137 XP_003820009.1.60992 XP_004052359.1.27298 XP_009005266.1.60252 XP_009005267.1.60252 XP_009005268.1.60252 XP_009234386.1.23681 XP_009234387.1.23681 XP_011541199.1.92137 XP_012325666.1.9421 XP_012325667.1.9421 XP_012325668.1.9421 XP_012325669.1.9421 XP_017379085.1.71028 XP_017379087.1.71028 XP_017379088.1.71028 XP_522210.3.37143 ENSP00000299333 ENSCJAP00000014398 ENSP00000299333 ENSP00000376523 ENSP00000432785 NYSGRC-IgSF-SCN3B_HUMAN gi|9055238|ref|NP_060870.1| gi|93587332|ref|NP_001035241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]