SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001036004.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001036004.1.92137
Domain Number 1 Region: 316-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000492
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000549
Family Classic zinc finger, C2H2 0.002
Further Details:      
 
Domain Number 3 Region: 389-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000054
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 4 Region: 186-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000346
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  NP_001036004.1.92137
Domain Number - Region: 130-139
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 452-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0102
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001036004.1.92137
Sequence length 493
Comment myc-associated zinc finger protein isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQ
SPFQAAPAPPPTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAAS
TVDTAALKQPPAPPPPPPPVSAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASAL
EKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQ
LSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLS
HSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVH
STERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV
CELCNKGFTTAAYLRIHAVKDHGLQAPRADRILCKLCSVHCKTPAQLAGHMQTHLGGAAP
PVPGDAPQPQPTC
Download sequence
Identical sequences A0A2J8TKA0 A0A2K5SGD2
ENSP00000219782 NP_001036004.1.87134 NP_001036004.1.92137 XP_017374664.1.71028 gi|110347459|ref|NP_001036004.1| 9606.ENSP00000219782 ENSP00000219782 ENSP00000313362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]