SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001040065.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001040065.1.76553
Domain Number 1 Region: 47-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-46
Family Regulator of G-protein signaling, RGS 0.000000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001040065.1.76553
Sequence length 205
Comment regulator of G-protein signaling 4 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHSKKDKVVICQRVSHEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQRKIFNLMEKDSYRRFLKSRFYLDLVNL
SSCGSEKQKGAKSSTDCASLVPQCA
Download sequence
Identical sequences Q29RM9
NP_001040065.1.59421 NP_001040065.1.76553 XP_005909320.1.15283 XP_010852962.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]