SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001041510.2.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001041510.2.100692
Domain Number 1 Region: 26-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.43e-67
Family MHC antigen-recognition domain 0.000000698
Further Details:      
 
Domain Number 2 Region: 209-301
Classification Level Classification E-value
Superfamily Immunoglobulin 5.62e-31
Family C1 set domains (antibody constant domain-like) 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001041510.2.100692
Sequence length 348
Comment RT1 class Ib, locus M5 isoform 2 precursor [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MGSSVFSVLLPLLLSRAWALNQVGAGIHSLQFFATAVTQPSSREHSFIFVGFVDDTQFLC
YNNQGESQRMEPRALWVKNMGPGYWERQTRMVKDISKNSLVNLREAMSVYNHSEDGTHVF
QCVSGCDVGPDGLFLRGHEQHAYDGRDYLALNKDLHSWTAGDTAAQITRRKWEEAGVAEQ
RRTYLKGECVESLRTYLEIGKETLLGADPPKAHVTHHPSPEGDNTLRCWALGFYPSDITL
TWQRDGEDLTQDMELVETRPGGDGTFQKWAAVVVPSGEEHRYTCCVEHEGLTEPLLLKWD
PSKHTIPIMGITAGLVFLGVAFTGAVVAIAMRKQRAHLERSDKYLTWT
Download sequence
Identical sequences ENSRNOP00000045665 NP_001041510.2.100692 NP_001041510.2.4139 10116.ENSRNOP00000045665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]