SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001068970.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001068970.1.59421
Domain Number 1 Region: 27-78
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000803
Family U-box 0.018
Further Details:      
 
Domain Number 2 Region: 222-275
Classification Level Classification E-value
Superfamily RING/U-box 0.00000609
Family U-box 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001068970.1.59421
Sequence length 302
Comment nitric oxide synthase-interacting protein [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTP
DGYLYEREAILEYILHQKKEIARQMKAYEKQRGARREEQKELQRAAAQDHVRGFLEKEAA
IVSRPLNPFTPKAASAGNGPDDAQPGSSAGPAGKDKDKALPSFWIPSLTPEAKATKLEKP
SRIVTCPMSGKPLRMSDLTPVRFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVL
RPSGAVVTLECVEKLIRKDMVDPVTGEKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVM
QA
Download sequence
Identical sequences Q3SWY5
ENSBTAP00000019215 NP_001068970.1.59421 NP_001068970.1.76553 XP_017918281.1.57651 XP_017918282.1.57651 XP_019834875.1.53367 ENSBTAP00000019215 9913.ENSBTAP00000019215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]