SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001069908.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001069908.1.76553
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000589
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001069908.1.76553
Sequence length 147
Comment sperm surface protein Sp17 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDPAEW
GAKVDDRFYNNHAFKEQESPEKHEPGKENSQTSVKEKTALESPEEDKDMEENAALKIQAA
FRGHLAREEVKKMKSSDLEEEKTEKNE
Download sequence
Identical sequences Q3SYS3
NP_001069908.1.59421 NP_001069908.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]