SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001074241.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001074241.1.87134
Domain Number 1 Region: 29-121
Classification Level Classification E-value
Superfamily Immunoglobulin 7.69e-26
Family I set domains 0.0021
Further Details:      
 
Domain Number 2 Region: 123-219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-22
Family I set domains 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001074241.1.87134
Sequence length 273
Comment killer cell immunoglobulin-like receptor 2DL4 isoform b precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH
LHAVIRYSVAIILFTILPFFLLHRWCSKKKMLL
Download sequence
Identical sequences A0A0B4J1S6
NP_001074241.1.87134 NP_001074241.1.92137 ENSP00000351988 ENSP00000474834 ENSP00000351988 ENSP00000479014 ENSP00000479993 ENSP00000484019 ENSP00000484307 ENSP00000484336 gi|124107604|ref|NP_001074241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]