SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001076888.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001076888.1.59421
Domain Number 1 Region: 29-125
Classification Level Classification E-value
Superfamily Snake toxin-like 1.78e-24
Family Extracellular domain of cell surface receptors 0.029
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000809
Family Extracellular domain of cell surface receptors 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001076888.1.59421
Sequence length 358
Comment ly6/PLAUR domain-containing protein 3 precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MDPARKAGSWAVIWTTGWLLLLSLLLPEGAKALECYSCVQNADDGCSPQKMKTVKCAPGV
EVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLYGILAFIQLQQCSQDRCNTKLN
LTSRGLNPAGNESAYQPNGVECYSCVGLSRKECQGRAPPVVSCYNASDHFYKGCFDGNVT
LTAANVTVSLPVRGCVQDEFCTRDSATGPGFTLSGSCCQGSRCNSDLRNKTYFSPRFPPL
VLLPPPRSTTLAPNKSVSTSTSAPSSTVTTKATPVPTTTRSTTKAITPAQTNQTSPQEVG
HETFREEEASLAGGASGHQDRRNMGQDPIKDVTHSKGSAAPWAGWVTLLLAMAAGALL
Download sequence
Identical sequences A4FUZ7
NP_001076888.1.59421 NP_001076888.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]